PDB entry 6lbm
View 6lbm on RCSB PDB site
Description: Crystal Structure of FOXC2-DBD bound to a palindromic DNA sequence
Class: transcription
Keywords: Forkhead transcription, DNA binding specificity, TRANSCRIPTION
Deposited on
2019-11-14, released
2021-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-02-10, with a file datestamp of
2021-02-05.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ire0
Species: Homo sapiens [TaxId:9606]
- Chain 'B':
Compound: ire0
Species: Homo sapiens [TaxId:9606]
- Chain 'C':
Compound: Forkhead box protein C2
Species: Homo sapiens [TaxId:9606]
Gene: FOXC2, FKHL14, MFH1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6lbmc1, d6lbmc2 - Heterogens: MG, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>6lbmC (C:)
gpkppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnec
fvkvprddkkpgkgsywtldpdsynmfengsflrrrrrfkkkd
Sequence, based on observed residues (ATOM records): (download)
>6lbmC (C:)
pkppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecf
vkvprddkkgsywtldpdsynmfengsflrrrrrf