PDB entry 6lax

View 6lax on RCSB PDB site
Description: the mutant sam-vi riboswitch (u6c) bound to sam
Deposited on 2019-11-13, released 2020-01-01
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (55-mer)
    Species: Bifidobacterium angulatum, synthetic [TaxId:1683]
  • Chain 'B':
    Compound: RNA (55-mer)
    Species: Bifidobacterium angulatum, synthetic [TaxId:1683]
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-90)
      • engineered mutation (25)
      • engineered mutation (30)
      • engineered mutation (40)
      • expression tag (91-92)
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-End)
      • engineered mutation (25)
      • engineered mutation (30)
      • engineered mutation (40)
  • Chain 'E':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-90)
      • engineered mutation (25)
      • engineered mutation (30)
      • engineered mutation (40)
      • expression tag (91-92)
  • Heterogens: MSE, SAM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6laxC (C:)
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvkrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakma

    Sequence, based on observed residues (ATOM records):
    >6laxC (C:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvkrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiakma

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6laxD (D:)
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvkrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakma

    Sequence, based on observed residues (ATOM records):
    >6laxD (D:)
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvkrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiia

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6laxE (E:)
trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvkrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmriqyaktdsdiiakma