PDB entry 6l7r

View 6l7r on RCSB PDB site
Description: crystal structure of chaetomium gcp3 n-terminus and mozart1
Deposited on 2019-11-02, released 2020-07-15
The last revision was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative spindle pole body component alp6 protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0063320
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SED1 (6-106)
      • expression tag (0-5)
  • Chain 'B':
    Compound: Mozart1
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0002490
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6l7rA (A:)
gplgsmqrinnaidslighlvpaaagddddartrrqavfdlvralleqpgsnipsdvnha
sdlikrrlistnpsqalrfsnlytrllalpvlnqkwailyllhqlad

    Sequence, based on observed residues (ATOM records):
    >6l7rA (A:)
gplgsmqrinnaidslighlvpaaagddddartrrqavfdlvralleqpgsnipvnhasd
likrrlistnpsqalrfsnlytrllalpvlnqkwailyllhqlad

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6l7rB (B:)
gphmppseraekqaaaqqavdilheiatilnchldrrtlsicismiengvnpealanvik
elrvlgqdpqqldalvanylassrrr

    Sequence, based on observed residues (ATOM records):
    >6l7rB (B:)
mppseraekqaaaqqavdilheiatilnchldrrtlsicismiengvnpealanvikelr
vlgqdpqqldalvanylas