PDB entry 6l6q

View 6l6q on RCSB PDB site
Description: Structural basis of NR4A2 homodimers binding to selective Nur-responsive elements
Class: DNA binding protein
Keywords: NR4A2, nuclear receptor, DNA BINDING PROTEIN
Deposited on 2019-10-29, released 2019-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nuclear receptor related 1
  Species: Homo sapiens [TaxId:9606]
  Gene: NR4A2
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1D8N6 (0-84)
  Domains in SCOPe 2.08: d6l6qa_
• Chain 'B':
  Compound: Nuclear receptor related 1
  Species: Homo sapiens [TaxId:9606]
  Gene: NR4A2
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1D8N6 (0-84)
  Domains in SCOPe 2.08: d6l6qb_
• Chain 'C':
  Compound: DNA (5'-d(p*ap*gp*tp*gp*ap*cp*cp*tp*tp*tp*ap*ap*ap*gp*gp*tp*cp*ap*cp*t)-3')
  Species: Homo sapiens [TaxId:9606]
  
• Chain 'F':
  Compound: DNA (5'-d(p*ap*gp*tp*gp*ap*cp*cp*tp*tp*tp*ap*ap*ap*gp*gp*tp*cp*ap*cp*t)-3')
  Species: Homo sapiens [TaxId:9606]
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6l6qA (A:)
  lcavcgdnaacqhygvrtcegckgffkrtvqknakyvclankncpvdkrrrnrcqycrfq
  kclavgmvkevvrtdslkgrrgrlp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6l6qB (B:)
  lcavcgdnaacqhygvrtcegckgffkrtvqknakyvclankncpvdkrrrnrcqycrfq
  kclavgmvkevvrtdslkgrrgrlp
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.