PDB entry 6l6d

View 6l6d on RCSB PDB site
Description: X-ray structure of human galectin-10 in complex with D-N-acetylgalactosamine
Class: sugar binding protein
Keywords: beta-sandwich structure, lectin, SUGAR BINDING PROTEIN
Deposited on 2019-10-28, released 2020-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: CLC, LGALS10, LGALS10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05315 (2-143)
      • variant (29)
    Domains in SCOPe 2.08: d6l6da_
  • Heterogens: NGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6l6dA (A:)
gsmsllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcf
grrvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikp
eavkmvqvwrdisltkfnvsylkr

    Sequence, based on observed residues (ATOM records): (download) 
    >6l6dA (A:)
msllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgr
rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
vkmvqvwrdisltkfnvsylkr