PDB entry 6l34

View 6l34 on RCSB PDB site
Description: Crystal structure of the HMG domain of human FACT complex subunit SSRP1
Class: chaperone
Keywords: Histone chaperone, CHAPERONE
Deposited on 2019-10-09, released 2020-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-20, with a file datestamp of 2021-01-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FACT complex subunit SSRP1
    Species: Homo sapiens [TaxId:9606]
    Gene: SSRP1, FACT80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6l34a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6l34A (A:)
krpmsaymlwlnasrekiksdhpgisitdlskkageiwkgmskekkeewdrkaedarrdy
ekamkeye