PDB entry 6l2m

View 6l2m on RCSB PDB site
Description: the structure of the trna-specific deaminase mutant from m. capricolum
Deposited on 2019-10-05, released 2020-08-12
The last revision was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside deaminase family protein
    Species: Mycoplasma capricolum subsp. capricolum [TaxId:40479]
    Gene: MCGM508_01875
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C2W6A5 (Start-143)
      • engineered mutation (18-21)
      • engineered mutation (104-105)
      • engineered mutation (142)
      • expression tag (144-147)
  • Heterogens: CL, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6l2mA (A:)
mddfnnildllineskkaaqlgdipvscciidsnnnilslainsryknkdisqhaeinvi
ndlisklnsfnlskyklittlepcmmcysaikqvkintiyylvddpkknnysindqnlnl
iqiknqkkqseyikllniffinarlehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6l2mA (A:)
ddfnnildllineskkaaqlgdipvscciidsnnnilslainsryknkdisqhaeinvin
dlisklnsfnlskyklittlepcmmcysaikqvkintiyylvddpkysindqnlnliqik
nqkkqseyikllniffinarlehh