PDB entry 6l27

View 6l27 on RCSB PDB site
Description: X-ray crystal structure of the mutant green fluorescent protein
Class: fluorescent protein
Keywords: GFP, mutant, recombinant, FLUORESCENT PROTEIN
Deposited on 2019-10-02, released 2020-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 0.77 Å
R-factor: N/A
AEROSPACI score: 1.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Green fluorescent protein
  Species: Aequorea victoria [TaxId:6100]
  Gene: GFP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42212 (1-228)
    • initiating methionine (0)
    • conflict (45)
    • conflict (61)
    • chromophore (63)
    • conflict (77)
    • conflict (156)
    • conflict (164)
  Domains in SCOPe 2.08: d6l27a_
• Heterogens: GYS, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6l27A (A:)
  mgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfisttgklpvpwptlvt
  tlsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
  ielkgidfkedgnilghkleynynshnvyimadkqkqgikvnfktrhniedgsvqladhy
  qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith