PDB entry 6kzr

View 6kzr on RCSB PDB site
Description: Crystal structure of mouse DCAR2 CRD domain
Class: sugar binding protein
Keywords: C-type lectin, SUGAR BINDING PROTEIN
Deposited on 2019-09-25, released 2020-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4, member b1
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4b1, Clec4b, Dcar
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D8Q7 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6kzra1, d6kzra2
  • Chain 'B':
    Compound: C-type lectin domain family 4, member b1
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4b1, Clec4b, Dcar
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D8Q7 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6kzrb1, d6kzrb2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kzrA (A:)
    mgsmcpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildi
    haayfiglwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndis
    cnlkqksvcqmkkinl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kzrA (A:)
    smcpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildiha
    ayfiglwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscn
    lkqksvcqmkki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6kzrB (B:)
    mgsmcpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildi
    haayfiglwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndis
    cnlkqksvcqmkkinl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kzrB (B:)
    smcpkdwklfgshcylvptvfssaswnkseencsrmgahlvvihsqeeqdfitgildiha
    ayfiglwdtghrqwqwvdqtpyeesvtfwhngepssdnekcvtvyyrrnigwgwndiscn
    lkqksvcqmkki