PDB entry 6kyg

View 6kyg on RCSB PDB site
Description: Crystal structure of the complex of phosphopantetheine adenylyltransferase from Acinetobacter baumannii with Phosphonoacetate at 2.19 A resolution.
Class: transferase
Keywords: CoA biosynthesis, Ligand, inhibitor, Coenzyme A, BIOSYNTHETIC PROTEIN, TRANSFERASE
Deposited on 2019-09-18, released 2019-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: coaD, HMPREF0010_01342
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6kyga_
  • Heterogens: MG, PAE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6kygA (A:)
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw