PDB entry 6ky3

View 6ky3 on RCSB PDB site
Description: Structure of arginine kinase H284A mutant
Class: transferase
Keywords: Arginine kinase, TRANSFERASE
Deposited on 2019-09-16, released 2020-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Daphnia magna [TaxId:35525]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0A7CK57 (5-361)
      • expression tag (0-4)
      • engineered mutation (288)
    Domains in SCOPe 2.08: d6ky3a1, d6ky3a2, d6ky3a3
  • Heterogens: ARG, PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ky3A (A:)
    hhhhhmvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviq
    sgvenldsgfgvyapdaeaysvfndlfepmicdyhtgfkpgdahpprdfgdletfgnldp
    egafivstrvrcgrslagyafnpclteanykemeekvvaslsslegelkgtyypltgmtk
    evqtqliqdrflfkegdrflqaanacrywptgrgiyhndaktflvwcneedhlriismqk
    ggdlkavyarlvnaineiekripfshhdkygfltfcptnlgttirasvaialpklaadla
    kleeaagkfnlqvrgtagehteaeggvydisnkrrmglteyqavkemydglqelirmeke
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ky3A (A:)
    hhhhhmvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviq
    sgvenldsgfgvyapdaeaysvfndlfepmicdyhtgfkpgdahpprdfgdletfgnldp
    egafivstrvrcgrslagyafnpclteanykemeekvvaslsslegelkgtyypltgmtk
    evqtqliqdrflfkegdrflqaanacrywptgrgiyhndaktflvwcneedhlriismqk
    ggdlkavyarlvnaineiekripfshhdkygfltfcptnlgttirasvaialpklaadla
    kleeaagkfnlqvrgggvydisnkrrmglteyqavkemydglqelirmekeaa