PDB entry 6ky2

View 6ky2 on RCSB PDB site
Description: Crystal Structure of Arginine Kinase wild type from Daphnia magna
Class: transferase
Keywords: Kinase, ATP binding protein, Arginine binding protein, TRANSFERASE
Deposited on 2019-09-16, released 2020-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Daphnia magna [TaxId:35525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ky2a1, d6ky2a2, d6ky2a3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ky2A (A:)
    hhhhmvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviqs
    gvenldsgfgvyapdaeaysvfndlfepmicdyhtgfkpgdahpprdfgdletfgnldpe
    gafivstrvrcgrslagyafnpclteanykemeekvvaslsslegelkgtyypltgmtke
    vqtqliqdrflfkegdrflqaanacrywptgrgiyhndaktflvwcneedhlriismqkg
    gdlkavyarlvnaineiekripfshhdkygfltfcptnlgttirasvhialpklaadlak
    leeaagkfnlqvrgtagehteaeggvydisnkrrmglteyqavkemydglqelirmekea
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ky2A (A:)
    hhhhmvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviqs
    gvenldsgfgvyapdaeaysvfndlfepmicdyhtgfkpgdahpprdfgdletfgnldpe
    gafivstrvrcgrslagyafnpclteanykemeekvvaslsslegelkgtyypltgmtke
    vqtqliqdrflfkegdrflqaanacrywptgrgiyhndaktflvwcneedhlriismqkg
    gdlkavyarlvnaineiekripfshhdkygfltfcptnlgttirasvhialpklaadlak
    laagkfnlqvrgtagehteaeggvydisnkrrmglteyqavkemydglqelirmekeaa