PDB entry 6kwk

View 6kwk on RCSB PDB site
Description: crystal structure of psla-1*0401 complex with fmdv-derived epitope mtahitvpy
Deposited on 2019-09-07, released 2020-09-09
The last revision was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Sus scrofa [TaxId:9823]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07717 (1-98)
      • expression tag (0)
  • Chain 'C':
    Compound: peptide
    Species: Foot-and-mouth disease virus, synthetic [TaxId:12110]
    Database cross-references and differences (RAF-indexed):
    • PDB 6KWK (0-8)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kwkA (A:)
gphslsyfytavsrpdrgdsrfiavgyvddtqfvrfdnyapnprmeprvpwiqqegqeyw
dretrnvketaqtygvglntlrgyynqseagshtlqsmygcylgpdglllhgyrqdaydg
adyialnedlrswtaadmaaqitkrkweaadeaerrrsylqglcveslrrylemgkdtlq
raeppkthvtrhpssdlgvtlrcwalgfypkeisltwqregqdqsqdmelvetrpsgdgt
fqkwaalvvppgeeqsytchvqheglqepltlrwd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6kwkB (B:)
fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw
sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6kwkC (C:)
mtahitvpy