PDB entry 6kwc

View 6kwc on RCSB PDB site
Description: Crystal Structure Analysis of Endo-beta-1,4-xylanase II
Class: hydrolase
Keywords: Xylanase II, Xylotriose, HYDROLASE
Deposited on 2019-09-06, released 2021-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Trichoderma reesei RUT C-30 [TaxId:1344414]
    Gene: xyn2, M419DRAFT_124931
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (2-190)
      • expression tag (0-1)
      • engineered mutation (44)
      • engineered mutation (177)
    Domains in SCOPe 2.08: d6kwca1, d6kwca2
  • Heterogens: GOL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6kwcA (A:)
    gstiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkv
    infsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyr
    tqrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgy
    fssgsasitvs