PDB entry 6kv2

View 6kv2 on RCSB PDB site
Description: Crystal structure of trypsin inhibitor 1 from Senna obtusifolia
Class: oxidoreductase
Keywords: trypsin inhibitor, OXIDOREDUCTASE
Deposited on 2019-09-03, released 2020-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor 1
    Species: Senna obtusifolia [TaxId:346985]
    Gene: TI1
    Database cross-references and differences (RAF-indexed):
    • PDB 6KV2 (Start-190)
    Domains in SCOPe 2.07: d6kv2a1, d6kv2a2
  • Chain 'B':
    Compound: trypsin inhibitor 1
    Species: Senna obtusifolia [TaxId:346985]
    Gene: TI1
    Database cross-references and differences (RAF-indexed):
    • PDB 6KV2 (0-190)
    Domains in SCOPe 2.07: d6kv2b1, d6kv2b2
  • Chain 'C':
    Compound: trypsin inhibitor 1
    Species: Senna obtusifolia [TaxId:346985]
    Gene: TI1
    Database cross-references and differences (RAF-indexed):
    • PDB 6KV2
    Domains in SCOPe 2.07: d6kv2c1, d6kv2c2
  • Chain 'D':
    Compound: trypsin inhibitor 1
    Species: Senna obtusifolia [TaxId:346985]
    Gene: TI1
    Database cross-references and differences (RAF-indexed):
    • PDB 6KV2
    Domains in SCOPe 2.07: d6kv2d1, d6kv2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kv2A (A:)
    gasgsmivfdsdgdflrnggtymlsppnggggilaaaikqgsdrdcslgviqhesytgwp
    vtisalvrptfistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgsl
    ffiksydssknyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkvnkgn
    fafesnlsmvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kv2A (A:)
    gsmivfdsdgdflrnggtymlsppnggggilaaaikdcslgviqhesytgwpvtisalvr
    ptfistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgslffiksyds
    sknyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkvnkgnfafesnls
    mvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6kv2B (B:)
    gasgsmivfdsdgdflrnggtymlsppnggggilaaaikqgsdrdcslgviqhesytgwp
    vtisalvrptfistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgsl
    ffiksydssknyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkvnkgn
    fafesnlsmvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6kv2C (C:)
    gasgsmivfdsdgdflrnggtymlsppnggggilaaaikqgsdrdcslgviqhesytgwp
    vtisalvrptfistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgsl
    ffiksydssknyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkvnkgn
    fafesnlsmvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kv2C (C:)
    smivfdsdgdflrnggtymlsppnggggilaaaikqdcslgviqhesytgwpvtisalvr
    ptfistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgslffiksyds
    sknyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkvnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6kv2D (D:)
    gasgsmivfdsdgdflrnggtymlsppnggggilaaaikqgsdrdcslgviqhesytgwp
    vtisalvrptfistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgsl
    ffiksydssknyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkvnkgn
    fafesnlsmvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kv2D (D:)
    gsmivfdsdgdflrnggtymlsppnggggilaaaicslgviqhesytgwpvtisalvrpt
    fistsfqlllsfayippnvctknsdwiikssndfegtvmlgddknpvgslffiksydssk
    nyyklvvcggrgdehcrnigvdkdengykrlvvtegeplvlqfdkv