PDB entry 6kum

View 6kum on RCSB PDB site
Description: Ferredoxin I from C. reinhardtii, low X-ray dose
Class: electron transport
Keywords: [2Fe2S] cluster, electron transport
Deposited on 2019-09-02, released 2020-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: petF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6kuma_
  • Chain 'B':
    Compound: Ferredoxin, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: petF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6kumb_
  • Heterogens: FES, BEN, SCN, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6kumA (A:)
aykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
sflddaqmgngfvltcvayptsdctiqthqeealy

    Sequence, based on observed residues (ATOM records): (download) 
    >6kumA (A:)
aykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
sflddaqmgngfvltcvayptsdctiqthqeeal

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6kumB (B:)
aykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
sflddaqmgngfvltcvayptsdctiqthqeealy