PDB entry 6kts

View 6kts on RCSB PDB site
Description: structure of c34n126k/n36
Deposited on 2019-08-28, released 2020-09-16
The last revision was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glycoprotein 41
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6TAN7 (0-33)
    • engineered mutation (9)
• Chain 'B':
  Compound: Envelope glycoprotein
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7F2J9 (0-35)
• Chain 'C':
  Compound: Glycoprotein 41
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6TAN7 (0-33)
    • engineered mutation (9)
• Chain 'D':
  Compound: Glycoprotein 41
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6TAN7 (0-33)
    • engineered mutation (9)
• Chain 'E':
  Compound: Envelope glycoprotein
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7F2J9 (0-35)
• Chain 'N':
  Compound: Envelope glycoprotein
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7F2J9 (0-35)
• Heterogens: ACE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ktsA (A:)
  wmewdreinkytslihslieesqnqqekneqell
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ktsB (B:)
  sgivqqqnnllraieaqqhllqltvwgikqlqaril
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ktsC (C:)
  wmewdreinkytslihslieesqnqqekneqell
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ktsD (D:)
  wmewdreinkytslihslieesqnqqekneqell
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ktsE (E:)
  sgivqqqnnllraieaqqhllqltvwgikqlqaril
  

  
  
• Chain 'N':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ktsN (N:)
  sgivqqqnnllraieaqqhllqltvwgikqlqaril