PDB entry 6ks1

View 6ks1 on RCSB PDB site
Description: Crystal structure of the human adiponectin receptor 2
Class: membrane protein/immune system
Keywords: membrane protein, MEMBRANE PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-08-10, released 2020-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Adiponectin receptor protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ADIPOR2, PAQR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86V24 (5-End)
    • expression tag (3-4)
• Chain 'H':
  Compound: The heavy chain variable domain (Antibody)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6KS1 (0-118)
  Domains in SCOPe 2.08: d6ks1h_
• Chain 'L':
  Compound: The light chain variable domain (Antibody)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 6KS1 (0-106)
  Domains in SCOPe 2.08: d6ks1l_
• Heterogens: ZN, OLA, OLB, OLC, LPX, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ks1H (H:)
  evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
  nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ks1L (L:)
  diqmtqspaslsasvgetvtitcrasgnihnflawyqqkqgkspqvlvynaktladgvps
  rfsgsgsgtqyslkinslqpedfgsyycqqfwstpytfgggtklein