PDB entry 6krw

View 6krw on RCSB PDB site
Description: Crystal Structure of AtPTP1 at 1.4 angstrom
Class: hydrolase
Keywords: classical protein tyrosine phosphatase, Arabidopsis thaliana, HYDROLASE
Deposited on 2019-08-22, released 2020-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-tyrosine-phosphatase PTP1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PTP1, At1g71860, F14O23.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6krwa_
  • Heterogens: IOD, FLC, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6krwA (A:)
    sklslssdqlnhchqalgvfrgkiqnpdsiaheftglqanrmwpselllnstvamnsvnv
    eknrysdvvpfdknrivlnpckdssakgyvnasliktsesesisqfiatqgplphtmedf
    wemviqqhcpiivmltrlvdnnrtvkcgdyfqdedgprefgnislttkwikttdtslmlr
    nlevnyketedqpmsvlhiqypewpdhgvpkdtvavreilkrlyqvppslgpiivhcsag
    igrtgtycaihntiqrilagdmsaldlaktvalfrkqrigmvqtmdqyffcynaivdele
    dltagt