PDB entry 6kqv

View 6kqv on RCSB PDB site
Description: solution structure of the ubl domain of usp19
Deposited on 2019-08-19, released 2020-08-19
The last revision was dated 2020-12-23, with a file datestamp of 2020-12-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 19
    Species: Homo sapiens [TaxId:9606]
    Gene: USP19, KIAA0891, ZMYND9
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kqvA (A:)
kqkvlpvfyfarephskpikflvsvskenstasevldslsqsvhvkpenlrlaeviknrf
hrvflpshsldtvspsdtllcfellsse