PDB entry 6kqu

View 6kqu on RCSB PDB site
Description: Crystal structure of phospholipase A2
Class: hydrolase
Keywords: phospholipase A2, Mutation, calcium, HYDROLASE
Deposited on 2019-08-18, released 2020-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Group IIE secretory phospholipase A2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G2E
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZK7 (Start-122)
      • engineered mutation (20)
    Domains in SCOPe 2.08: d6kqua_
  • Heterogens: CA, GOL, CL, NA, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6kquA (A:)
nlvqfgvmiekmtgksalqygdygcycgiggshwpvdqtdwcchahdccygrleklgcep
klekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgpt
ppc

    Sequence, based on observed residues (ATOM records): (download) 
    >6kquA (A:)
vqfgvmiekmtgksalqygdygcycgiggshwpvdqtdwcchahdccygrleklgcepkl
ekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgptpp
c