PDB entry 6kmj

View 6kmj on RCSB PDB site
Description: crystal structure of sth1 bromodomain in complex with h3k14ac
Deposited on 2019-07-31, released 2019-11-27
The last revision was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear protein STH1/NPS1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: STH1, NPS1, YIL126W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: histone h3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), synthetic [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61830 (0-15)
      • expression tag (16)
  • Heterogens: ALY, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kmjA (A:)
slgifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknc
kngtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehss

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6kmjC (C:)
tarkstggkaprkqlay