PDB entry 6kjy

View 6kjy on RCSB PDB site
Description: Galectin-13 variant C136S/C138S
Class: sugar binding protein
Keywords: Galectin-13 variant C136S/C138S, SUGAR BINDING PROTEIN
Deposited on 2019-07-23, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactoside-binding soluble lectin 13
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS13, PLAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHV8 (3-141)
      • variant (138)
      • variant (140)
    Domains in SCOPe 2.07: d6kjya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kjyA (A:)
    gshmsslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafrfrvh
    fgnhvvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrip
    psfvkmvqvsrdisltsvsvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kjyA (A:)
    msslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafrfrvhfgn
    hvvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsf
    vkmvqvsrdisltsvsvsn