PDB entry 6kjn

View 6kjn on RCSB PDB site
Description: the microtubule-binding domains of yeast cytoplasmic dynein in the high affinity state
Deposited on 2019-07-22, released 2020-03-18
The last revision was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein heavy chain, cytoplasmic
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: DYN1, DHC1, YKR054C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36022 (3-140)
      • expression tag (0-2)
      • engineered mutation (9)
      • engineered mutation (130)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kjnA (A:)
gshmksiqdceptileaqrgvknikkqqlteirsmvnppsgvkivmeavcailgyqfsnw
rdiqqfirkddfihnivhydttlhmkpqirkymeeeflsdpnftyetinraskacgplyq
wvnaqinfskclenvdplrqe