PDB entry 6kiy

View 6kiy on RCSB PDB site
Description: crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat
Deposited on 2019-07-20, released 2019-09-25
The last revision was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, aldo/keto reductase family
    Species: Thermotoga maritima MSB8 [TaxId:243274]
    Gene: TM_1743
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X265 (1-274)
      • expression tag (0)
  • Heterogens: EPR, NAP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kiyA (A:)
smlykelgrtgeeipalglgtwgiggfetpdysrdeemvellktaikmgythidtaeyyg
gghteeligkaikdfrredlfivskvwpthlrrddllrslentlkrldtdyvdlylihwp
npeipleetlsamaegvrqgliryigvsnfdrrlleeaisksqepivcdqvkyniedrdp
erdgllefcqkngvtlvaysplrrtllsektkrtleeiaknhgatiyqimlawllakpnv
vaipkagrvehlrenlkateiklseeemklldslg