PDB entry 6khj

View 6khj on RCSB PDB site
Description: Supercomplex for electron transfer
Class: electron transport
Keywords: Supercomplex, cyanobacteria, cyclic electron transport, ELECTRON TRANSPORT
Deposited on 2019-07-15, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P)H-quinone oxidoreductase subunit 1
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: NAD(P)H-quinone oxidoreductase subunit 2
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: NAD(P)H-quinone oxidoreductase subunit 3
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: NAD(P)H-quinone oxidoreductase chain 4 1
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: NAD(P)H-quinone oxidoreductase subunit 4L
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: NADH dehydrogenase subunit 5
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: nadh-quinone oxidoreductase subunit j
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: NAD(P)H-quinone oxidoreductase subunit H
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6khjh_
  • Chain 'I':
    Compound: NAD(P)H-quinone oxidoreductase subunit I
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: NAD(P)H-quinone oxidoreductase subunit J
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: NAD(P)H-quinone oxidoreductase subunit K
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: NAD(P)H-quinone oxidoreductase subunit L
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: NAD(P)H-quinone oxidoreductase subunit M
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: NAD(P)H-quinone oxidoreductase subunit N
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: NAD(P)H-quinone oxidoreductase subunit O
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: proton-translocating NADH-quinone dehydrogenase subunit P
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • PDB 6KHJ (Start-43)
  • Chain 'Q':
    Compound: proton-translocating NADH-quinone dehydrogenase subunit Q
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • PDB 6KHJ (Start-44)
  • Chain 'S':
    Compound: Tlr0636 protein
    Species: Thermosynechococcus elongatus BP-1 [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BCR, DGD, LHG, LMG, PL9, SF4, SQD, LMT

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6khjH (H:)
    mpkietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtn
    imfipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgp
    fladvgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfc
    dyflpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhy
    ecyddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlega
    ksewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdf
    nnlqvlpqllkgmkvadivailgsidvimgsvdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6khjH (H:)
    pkietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtni
    mfipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgpf
    ladvgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfcd
    yflpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhye
    cyddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlegak
    sewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdfn
    nlqvlpqllkgmkvadivailgsidvimgsvdr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'S':
    No sequence available.