PDB entry 6kha

View 6kha on RCSB PDB site
Description: solution structure of bovine insulin amyloid intermediate-2
Deposited on 2019-07-14, released 2020-08-12
The last revision was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin A chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin B chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6khaA (A:)
giveqccasvcslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6khaB (B:)
fvnqhlcgshlvealylvcgergffytpka