PDB entry 6kg9

View 6kg9 on RCSB PDB site
Description: solution structure of cadoc0917 from clostridium acetobutylicum
Deposited on 2019-07-11, released 2020-07-08
The last revision was dated 2020-11-04, with a file datestamp of 2020-10-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: And cellulose-binding endoglucanase family 9 CelL ortholog dockerin domain
    Species: Clostridium acetobutylicum ATCC 824 [TaxId:272562]
    Gene: CA_C0917
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97KK2 (4-64)
      • expression tag (0-3)
      • expression tag (65-66)
  • Heterogens: CA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kg9A (A:)
gsasntilgdlnddgvvngrdivmmrqylagktvsgidknaldingdgavngrdlmelik
kvsnnts