PDB entry 6kfz

View 6kfz on RCSB PDB site
Description: SufS from Bacillus subtilis, soaked with L-cysteine for 90 sec at 1.96 angstrom resolution
Class: biosynthetic protein
Keywords: iron, sulfur, cysteine desulfurase, reaction intermediate, BIOSYNTHETIC PROTEIN
Deposited on 2019-07-09, released 2019-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase SufS
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufS, csd, yurW, BSU32690
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32164 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.08: d6kfza1, d6kfza2
  • Heterogens: C6P, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kfzA (A:)
    mghmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvh
    tlgtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvit
    ymehhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgt
    vnpikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygk
    kallenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigld
    eisrhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavra
    ghhcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kfzA (A:)
    hmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtl
    gtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvitym
    ehhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvn
    pikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkka
    llenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldei
    srhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavragh
    hcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnv