PDB entry 6kfy

View 6kfy on RCSB PDB site
Description: SufS from Bacillus subtilis in a resting state at 1.96 angstrom resolution
Class: biosynthetic protein
Keywords: Iron, sulfur, cysteine desulfurase, resting state, BIOSYNTHETIC PROTEIN
Deposited on 2019-07-09, released 2020-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase SufS
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufS, csd, yurW, BSU32690
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32164 (3-408)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d6kfya1, d6kfya2
  • Heterogens: PGE, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kfyA (A:)
    mghmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvh
    tlgtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvit
    ymehhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgt
    vnpikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygk
    kallenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigld
    eisrhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavra
    ghhcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kfyA (A:)
    ghmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvht
    lgtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvity
    mehhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtv
    npikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkk
    allenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeiglde
    isrhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavrag
    hhcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnvf