PDB entry 6kfb

View 6kfb on RCSB PDB site
Description: hydroxynitrile lyase from the millipede, chamberlinius hualienensis bound with thiocyanate
Deposited on 2019-07-07, released 2020-07-08
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxynitrile lyase
    Species: Chamberlinius hualienensis [TaxId:1551368]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SCN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6kfbA (A:)
    ltcdqlpkaainpiqefidsnplefeyvltetfecttriyvqparwsttkaptaldikgt
    qimaydfvggpensahlnechtgdkqvwyfqytnlltdngssycayrcngteiieykcas
    nnngtdplqhqamevaktvpngdkihyaksncpethgcfafy