PDB entry 6kcj

View 6kcj on RCSB PDB site
Description: Crystal structure of H5N2 hemagglutinin Apo-Q226L mutant from A/chicken/Taiwan/0502/2012
Class: viral protein
Keywords: influenza virus, H5N2, VIRAL PROTEIN
Deposited on 2019-06-28, released 2019-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Taiwan/0502/2012(H5N2)) [TaxId:1490024]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059VBQ9 (40-540)
      • conflict (262)
      • expression tag (541-543)
    Domains in SCOPe 2.07: d6kcja1, d6kcja2, d6kcja3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kcjA (A:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvnglsgrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kcjA (A:)
    gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
    wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
    sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
    hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvnglsgrmeffwtilrpndsi
    tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
    gecpkyvklkklvlatglrnigaiagfieggwqgmvdgwygyhhsneqgsgyaadkestq
    kavdgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlm
    enertldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqy
    seesrlkreeidsgl