PDB entry 6kbr

View 6kbr on RCSB PDB site
Description: Crystal structure of Human KLK4 and SPINK2 derived KLK4 inhibitor complex
Class: hydrolase/hydrolase inhibitor
Keywords: Protein engineering, Cystine knot protein, Protease inhibitor, Structural analysis, PROTEIN BINDING, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2019-06-26, released 2019-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-4
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK4, EMSP1, PRSS17, PSTS
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: k41043
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6KBR (Start-64)
    Domains in SCOPe 2.07: d6kbrc_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6kbrC (C:)
    pqfglfskyrtpncrrysihgcnrmyapvcgsdmstyanectlcmkiregghnikiikng
    pcgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kbrC (C:)
    tpncrrysihgcnrmyapvcgsdmstyanectlcmkiregghnikiikngpcgas