PDB entry 6k61

View 6k61 on RCSB PDB site
Description: Cryo-EM structure of the tetrameric photosystem I from a heterocyst-forming cyanobacterium Anabaena sp. PCC7120
Class: photosynthesis
Keywords: Photosystem I, PSI, PCC7120, PHOTOSYNTHESIS
Deposited on 2019-05-31, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: EM
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61a_
  • Chain 'B':
    Compound: Photosystem I P700 chlorophyll a apoprotein A2 1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61b_
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Photosystem I reaction center subunit II
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: photosystem I reaction center subunit IV
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61e_
  • Chain 'F':
    Compound: Photosystem I reaction center subunit III
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61f_
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61j_
  • Chain 'K':
    Compound: Photosystem I reaction center subunit PsaK 1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Photosystem I reaction center subunit XI
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61l_
  • Chain 'M':
    Compound: Photosystem I reaction center subunit XII
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61m_
  • Chain 'X':
    Compound: Photosystem I 4.8 kDa protein
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Photosystem I P700 chlorophyll a apoprotein A2 1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: photosystem I iron-sulfur center
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61c_
  • Chain 'd':
    Compound: Photosystem I reaction center subunit II
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k61d_
  • Chain 'e':
    Compound: photosystem I reaction center subunit IV
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Photosystem I reaction center subunit III
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Photosystem I reaction center subunit VIII
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem I reaction center subunit IX
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Photosystem I reaction center subunit PsaK 1
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem I reaction center subunit XI
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Photosystem I reaction center subunit XII
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Photosystem I 4.8 kDa protein
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BCR, CLA, CL0, LHG, LMG, PQN, SF4, SQD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6k61A (A:)
    mtisppereekkarvivdkdpvptsfekwaqpghfdrtlargpktttwiwnlhalahdfd
    thtsdledisrkifaahfghlavvtiwlsgmifhgakfsnyeawlsdplnvrpsaqvvwp
    ivgqdilngdvgggfhgiqitsglfqvwrgwgitnsfqlyctaigglvlaglflfagwfh
    yhkrapklewfqnvesmlnhhlqvllgcgslgwaghlihvsapinklmdagvavkdiplp
    hefilnksllidlfpgfaagltpfftlnwgqyadfltfkgglnpvtgglwmtdiahhhla
    iavvfiiaghqyrtnwgighsikeilenhkgpftgeghkglyenlttswhaqlatnlafl
    gsltiiiahhmyamppypylatdyatqlcifthhiwiggflivggaahaaifmvrdydpv
    vnqnnvldrvirhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlq
    pvfaqwvqnlhtlapggtapnalepvsyafgggvlavggkvammpialgtadflihhiha
    ftihvtvlillkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmy
    nslsivifhfswkmqsdvwgtvdaagnvshitggnfaqsaitingwlrdflwaqasqvin
    sygsalsayglmflgahfvwafslmflfsgrgywqeliesivwahnklkvapaiqprals
    itqgravgvahyllggiattwaffhahilsvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61A (A:)
    kkarvivdkdpvptsfekwaqpghfdrtlargpktttwiwnlhalahdfdthtsdledis
    rkifaahfghlavvtiwlsgmifhgakfsnyeawlsdplnvrpsaqvvwpivgqdilngd
    vgggfhgiqitsglfqvwrgwgitnsfqlyctaigglvlaglflfagwfhyhkrapklew
    fqnvesmlnhhlqvllgcgslgwaghlihvsapinklmdagvavkdiplphefilnksll
    idlfpgfaagltpfftlnwgqyadfltfkgglnpvtgglwmtdiahhhlaiavvfiiagh
    qyrtnwgighsikeilenhkgpftgeghkglyenlttswhaqlatnlaflgsltiiiahh
    myamppypylatdyatqlcifthhiwiggflivggaahaaifmvrdydpvvnqnnvldrv
    irhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpvfaqwvqnl
    htlapggtapnalepvsyafgggvlavggkvammpialgtadflihhihaftihvtvlil
    lkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivifhf
    swkmqsdvwgtvdaagnvshitggnfaqsaitingwlrdflwaqasqvinsygsalsayg
    lmflgahfvwafslmflfsgrgywqeliesivwahnklkvapaiqpralsitqgravgva
    hyllggiattwaffhahilsvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6k61B (B:)
    matkfpkfsqdlaqdpttrriwyamamgndfeshdgmteenlyqkifathfghlaiiflw
    assllfhvawqgnfeqwikdplhvrpiahaiwdphfgkpaieaftqagangpvniaysgv
    yhwwytigmrtntelytgsvflllfaslflfagwlhlqpkfrpslawfksaesrlnhhla
    glfgvsslawaghlihvaipesrgqhvgwdnflstaphpaglqpfftgnwgvyaqnpdta
    ghifstsqgagtailtflggfhpqteslwltdmahhhlaiavlfivaghmyrtnfgighs
    ikemmnaktffgkpvegpfnmphqgiydtynnslhfqlgwhlaclgvvtswvaqhmyslp
    syafiakdyttqaalythhqyiaiflmvgafahgaiflvrdydpeqnkgnvlervlqhke
    aiishlswvslflgfhtlglyvhndvvvafgtpekqiliepvfaqfiqaahgkvlygldt
    llsnpdsvaytaypnyanvwlpgwldainsgtnslfltigpgdflvhhaialglhtttli
    lvkgaldargsklmpdkkdfgyafpcdgpgrggtcdisawdsfylslfwalntvgwvtfy
    whwkhlgiwqgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfg
    hlvwatgfmfliswrgywqelietlvwahertpianlvrwkdkpvalsivqarvvglahf
    tvgyvltyaafliastagkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61B (B:)
    atkfpkfsqdlaqdpttrriwyamamgndfeshdgmteenlyqkifathfghlaiiflwa
    ssllfhvawqgnfeqwikdplhvrpiahaiwdphfgkpaieaftqagangpvniaysgvy
    hwwytigmrtntelytgsvflllfaslflfagwlhlqpkfrpslawfksaesrlnhhlag
    lfgvsslawaghlihvaipesrgqhvgwdnflstaphpaglqpfftgnwgvyaqnpdtag
    hifstsqgagtailtflggfhpqteslwltdmahhhlaiavlfivaghmyrtnfgighsi
    kemmnaktffgkpvegpfnmphqgiydtynnslhfqlgwhlaclgvvtswvaqhmyslps
    yafiakdyttqaalythhqyiaiflmvgafahgaiflvrdydpeqnkgnvlervlqhkea
    iishlswvslflgfhtlglyvhndvvvafgtpekqiliepvfaqfiqaahgkvlygldtl
    lsnpdsvaytaypnyanvwlpgwldainsgtnslfltigpgdflvhhaialglhtttlil
    vkgaldargsklmpdkkdfgyafpcdgpgrggtcdisawdsfylslfwalntvgwvtfyw
    hwkhlgiwqgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfgh
    lvwatgfmfliswrgywqelietlvwahertpianlvrwkdkpvalsivqarvvglahft
    vgyvltyaafliastagkfg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6k61E (E:)
    mvqrgskvrilrpesywfqdvgtvasvdqsgikypvivrfdkvnyagintnnfavdelie
    veapkakakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61E (E:)
    vqrgskvrilrpesywfqdvgtvasvdqsgikypvivrfdkvnyagintnnfavdeliev
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6k61F (F:)
    mrrlfalilviclsfsfappakalgadltpcaenpafqalaknarnttadpqsgqkrfer
    ysqalcgpegyphlivdgrldragdflipsilflyiagwigwvgraylqaikkdsdteqk
    eiqldlgialpiiatgfawpaaavkellsgeltakdseitvspr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61F (F:)
    lgadltpcaenpafqalaknarnttadpqsgqkrferysqalcgpegyphlivdgrldra
    gdflipsilflyiagwigwvgraylqaikkdsdteqkeiqldlgialpiiatgfawpaaa
    vkellsgeltakdseitvspr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6k61J (J:)
    madkadqssylikfistapvaatiwltitagiliefnrffpdllfhplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61J (J:)
    adqssylikfistapvaatiwltitagiliefnrffpdllfhplp
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6k61L (L:)
    maqavdasknlpsdprnrevvfpagrdpqwgnletpvnasplvkwfinnlpayrpgltpf
    rrglevgmahgyflfgpfaklgplrdaananlagllgaiglvvlftlalslyansnppta
    lasvtvpnppdafqskegwnnfasafliggiggavvayfltsnlaliqglvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61L (L:)
    nrevvfpagrdpqwgnletpvnasplvkwfinnlpayrpgltpfrrglevgmahgyflfg
    pfaklgplrdaananlagllgaiglvvlftlalslyansnpptalasvtvpnppdafqsk
    egwnnfasafliggiggavvayfltsnlaliqglv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6k61M (M:)
    mssisdtqvyialvvalipgllawrlatelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61M (M:)
    ssisdtqvyialvvalipgllawrlatelyk
    

  • Chain 'X':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    Sequence, based on SEQRES records: (download)
    >6k61c (c:)
    mshtvkiydtcigctqcvracptdvlemvpwdgckaaqvassprtedcvgckrcetacpt
    dflsirvylgaettrsmglay
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61c (c:)
    shtvkiydtcigctqcvracptdvlemvpwdgckaaqvassprtedcvgckrcetacptd
    flsirvylgaettrsmglay
    

  • Chain 'd':
    Sequence, based on SEQRES records: (download)
    >6k61d (d:)
    maetlsgktplfagstgglltkaveeekyaitwtspkaqvfelptggaatmhegenllyi
    arkeygialggqlrkfkitnykiyrilpsgettfihpadgvfpekvnagrekvrfnarsi
    genpnpsqvkfsgkatyda
    

    Sequence, based on observed residues (ATOM records): (download)
    >6k61d (d:)
    tlsgktplfagstgglltkaveeekyaitwtspkaqvfelptggaatmhegenllyiark
    eygialggqlrkfkitnykiyrilpsgettfihpadgvfpekvnagrekvrfnarsigen
    pnpsqvkfsgkatyda
    

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'x':
    No sequence available.