PDB entry 6k5t

View 6k5t on RCSB PDB site
Description: complex of sumo1 and phosphorylated hcmv protein ie2
Deposited on 2019-05-31, released 2019-08-07
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 1
  Species: Homo sapiens [TaxId:9606]
  Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63165 (0-76)
• Chain 'B':
  Compound: 12-mer from Viral transcription factor IE2
  Species: Human cytomegalovirus (strain AD169), synthetic [TaxId:10360]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19893 (0-11)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6k5tA (A:)
  yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
  gmeeedvievyqeqtgg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6k5tB (B:)
  dtagcivisdse