PDB entry 6k50

View 6k50 on RCSB PDB site
Description: solution structure of plectasin derivative nz2114
Deposited on 2019-05-28, released 2019-06-12
The last revision was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plectasin derivative nz2114
    Species: Pseudoplectania nigrella, synthetic [TaxId:96584]
    Database cross-references and differences (RAF-indexed):
    • PDB 6K50 (0-39)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6k50A (A:)
gfgcngpwneddlrchnhcksikgykggycakggfvckcy