PDB entry 6k4i

View 6k4i on RCSB PDB site
Description: The partially disordered conformation of ubiquitin (Q41N variant)
Class: structural protein
Keywords: pressure, partially disordered conformation, structural protein
Deposited on 2019-05-24, released 2019-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Gene: UBB
  Database cross-references and differences (RAF-indexed):
  • Uniprot J3QS39 (0-75)
    • engineered mutation (40)
  Domains in SCOPe 2.07: d6k4ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6k4iA (A:)
  mqifvktltgktitlevepsdtienvkakiqdkegippdqnrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg