PDB entry 6k2n

View 6k2n on RCSB PDB site
Description: Structural basis of glycan recognition in globally predominant human P[8] rotavirus
Class: viral protein
Keywords: glycan binding specificity, VP8* structure, mucin core 2, lacto-N-fucopentaose 1 (LNFP1), VIRAL PROTEIN
Deposited on 2019-05-15, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k2na_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k2nb_
  • Chain 'C':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k2nc_
  • Chain 'D':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k2nd_
  • Chain 'E':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k2ne_
  • Chain 'F':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6k2nf_
  • Heterogens: A2G, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6k2nA (A:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6k2nB (B:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6k2nC (C:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6k2nD (D:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6k2nE (E:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6k2nF (F:)
    ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
    enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
    ttdssntanlndisiiihsefyiiprsqeskcneyinngl