PDB entry 6k1w

View 6k1w on RCSB PDB site
Description: crystal structure of rhodothermus marinus substrate-binding protein at ph 5.5
Deposited on 2019-05-13, released 2019-08-21
The last revision was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC-type uncharacterized transport system periplasmic component-like protein
    Species: Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) [TaxId:518766]
    Gene: Rmar_2176
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6k1wA (A:)
gshmpetetevtpiqqlflikelkpgiarigviwdknaanrdevlpqlqrasaatgikvv
vaevaslqevapqfrtllrdhqvealwvleesgllgqaaarsfliknatqagmpvfapse
twlkegacvtwrkdaegirlvvnkavaeamgitipakyqdrtaflamn

    Sequence, based on observed residues (ATOM records):
    >6k1wA (A:)
evtpiqqlflikelkpgiarigviwdknaanrdevlpqlqrasaatgikvvvaevaslqe
vapqfrtllrdhqvealwvleesgllgqaaarsfliknatqagmpvfapsetwlkegacv
twrkirlvvnkavaeamgitipakyqtaf