PDB entry 6jzw

View 6jzw on RCSB PDB site
Description: Crystal structure of SufU from Bacillus subtilis with Cys persulfurated
Class: biosynthetic protein
Keywords: Iron-sulfur cluster biosynthesis, Sulfur mobilization, BIOSYNTHETIC PROTEIN
Deposited on 2019-05-04, released 2020-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzwa_
  • Chain 'B':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzwb_
  • Chain 'C':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzwc_
  • Chain 'D':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzwd_
  • Heterogens: CSS, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jzwA (A:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzwA (A:)
    sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf
    egegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvsk
    fparikcatlswkalekgvake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jzwB (B:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzwB (B:)
    nanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfeg
    egcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfp
    arikcatlswkalekgva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jzwC (C:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzwC (C:)
    sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf
    egegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvsk
    fparikcatlswkalekgvake
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jzwD (D:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzwD (D:)
    nanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfeg
    egcsismasasmmtqaikgkdietalsmskifsdmmqgkelgdiealqgvskfparikca
    tlswkalekgva