PDB entry 6jzv

View 6jzv on RCSB PDB site
Description: Crystal structure of SufU from Bacillus subtilis
Class: biosynthetic protein
Keywords: Iron-sulfur cluster biosynthesis, Sulfur mobilization, BIOSYNTHETIC PROTEIN
Deposited on 2019-05-04, released 2020-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzva_
  • Chain 'B':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzvb_
  • Chain 'C':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzvc_
  • Chain 'D':
    Compound: Zinc-dependent sulfurtransferase SufU
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sufU, iscU, nifU, yurV, BSU32680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jzvd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jzvA (A:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzvA (A:)
    nanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfeg
    egcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfp
    arikcatlswkalekgvakee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jzvB (B:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzvB (B:)
    sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf
    egegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvsk
    fparikcatlswkalekgvak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jzvC (C:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzvC (C:)
    sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf
    egegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvsk
    fparikcatlswkalekgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jzvD (D:)
    msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedak
    fegegcsismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvs
    kfparikcatlswkalekgvakeeggnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jzvD (D:)
    sfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakf
    egegcsismasasmmtqaikgkdietalsmskifsdmmqgsidlgdiealqgvskfpari
    kcatlswkalekgvak