PDB entry 6jzp

View 6jzp on RCSB PDB site
Description: Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose
Class: hydrolase
Keywords: xylanase II, complex, Xylotriose, HYDROLASE
Deposited on 2019-05-03, released 2020-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase 2
  Species: Trichoderma reesei RUT C-30 [TaxId:1344414]
  Gene: xyn2, M419DRAFT_124931
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36217 (0-188)
    • conflict (42)
    • conflict (175)
  Domains in SCOPe 2.08: d6jzpa_
• Heterogens: GOL, IOD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jzpA (A:)
  tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin
  fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
  rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavngyfs
  sgsasitvs