PDB entry 6jy5

View 6jy5 on RCSB PDB site
Description: Structure of CsoS4B from Halothiobacillus neapolitanus
Class: structural protein
Keywords: carboxysome shell protein, pentameric protein, STRUCTURAL PROTEIN
Deposited on 2019-04-26, released 2019-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unidentified carboxysome polypeptide
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jy5a_
  • Chain 'B':
    Compound: Unidentified carboxysome polypeptide
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85044 (0-76)
      • expression tag (77-81)
    Domains in SCOPe 2.08: d6jy5b1, d6jy5b2
  • Chain 'C':
    Compound: Unidentified carboxysome polypeptide
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85044 (0-76)
      • expression tag (77)
    Domains in SCOPe 2.08: d6jy5c1, d6jy5c2
  • Chain 'D':
    Compound: Unidentified carboxysome polypeptide
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85044 (0-76)
      • expression tag (77-81)
    Domains in SCOPe 2.08: d6jy5d1, d6jy5d2
  • Chain 'E':
    Compound: Unidentified carboxysome polypeptide
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jy5e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jy5A (A:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy5A (A:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    eiltdltiggiid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jy5B (B:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy5B (B:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jy5C (C:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy5C (C:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jy5D (D:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy5D (D:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6jy5E (E:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
    vgdfeiltdltiggiidlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jy5E (E:)
    mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsgdfei
    ltdltiggiid