PDB entry 6jxu

View 6jxu on RCSB PDB site
Description: sumo1 bound to sls4-sim peptide from icp0
Deposited on 2019-04-25, released 2020-02-05
The last revision was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: viral protein
    Species: HUMAN HERPESVIRUS 1, synthetic [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JXU (0-11)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jxuA (A:)
msdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmn
slrflfegqriadnhtpkelgmeeedvievyqeqtgghstv

    Sequence, based on observed residues (ATOM records):
    >6jxuA (A:)
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6jxuB (B:)
nnrdpivisdsp