PDB entry 6jxl

View 6jxl on RCSB PDB site
Description: Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose
Class: hydrolase
Keywords: xylanase II, complex, Xylotriose, HYDROLASE
Deposited on 2019-04-23, released 2020-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Trichoderma reesei RUT C-30 [TaxId:1344414]
    Gene: xyn2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (0-188)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d6jxla_
  • Heterogens: XYP, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6jxlA (A:)
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgdfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs