PDB entry 6jvy

View 6jvy on RCSB PDB site
Description: crystal structure of rbm38 in complex with single-stranded dna
Deposited on 2019-04-17, released 2020-01-01
The last revision was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 38
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM38, RNPC1, SEB4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*tp*gp*tp*gp*tp*gp*tp*gp*tp*g)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jvyA (A:)
mgsshhhhhhssglvprgshmasmtggqqmgrgsqkdttftkifvgglpyhttdaslrky
fegfgdieeavvitdrqtgksrgygfvtmadraaaerackdpnpiidgrkanvnlaylga
kprslqtg

    Sequence, based on observed residues (ATOM records):
    >6jvyA (A:)
qkdttftkifvgglpyhttdaslrkyfegfgdieeavvitdrqtgksrgygfvtmadraa
aerackdpnpiidgrkanvnlaylga

  • Chain 'B':
    No sequence available.