PDB entry 6ju3

View 6ju3 on RCSB PDB site
Description: structure of influenza d virus polymerase bound to crna promoter in class 2
Deposited on 2019-04-12, released 2019-06-12
Made obsolete by 6kuv on 2019-10-02

The last revision was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: EM
Resolution: 4.1 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase 3
    Species: Influenza D virus [TaxId:1173138]
    Gene: P3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA-directed RNA polymerase catalytic subunit
    Species: Influenza D virus [TaxId:1173138]
    Gene: Pb1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Polymerase PB2
    Species: Influenza D virus [TaxId:1173138]
    Gene: pb2
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: RNA (5'-r(p*up*cp*cp*up*up*gp*cp*up*ap*cp*up*gp*cp*u)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'V':
    Compound: RNA (5'-r(p*ap*gp*cp*ap*up*ap*ap*gp*cp*ap*gp*gp*ap*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ju3A (A:)
    mssvireiakrfleqatiniaeevvreygdhertmisvgvhfqacclisdeytledettp
    ryvlleglkrqeaiskqnnicstlgleplrnladifdrktrrflevgitkresdeyyqek
    fnkigndmdihvftyegkyfsnnpnglediqktriftflsfvsdelrkenmftemyvtee
    gapelemyksklfiamrdesvplpyinyehlrtrcetfkrnqaeceakvadvasrlkikl
    ehleenklrpleipkekeapythkflmkdawffakphdseraqpqqilydffeaanmgfm
    ttspkpifgkqglmyhslwgqtkraikdkrnelepseqrdflcgigraskkiqedkwqes
    reeefkqeetkgaakrgfptwfneewlwamrdsgdgdnkigdwipmaemppcknemedya
    kkmceeleskiqgtncaremsklihtigslhtecrnfpgkvkivpiycrgtlrgestdcl
    fgiaikgkshlnkddgmytvvtfefsteepnpskhekytvfeagtvpveavvltpkrerv
    lkekklflycrttgmsklkndwfskcrrcliptmetveqivlkecalkeenrvsemlenk
    rawiahengenltrlvstklkdlcrmlivtqfyyciyndnqlegfcneqkkflmflqadk
    dsksaftfnqkglyekieecivsnplcifladrlnklflvaksngakyfe
    

    Sequence, based on observed residues (ATOM records):
    >6ju3A (A:)
    vireiakrfleqatiniaeevvreygdhertmisvgvhfqacclisdeytledettpryv
    lleglkrqeaiskqnnicstlgleplrnladifdrktrrflevgitkresdeyyqekfnk
    igndmdihvftyegkyfsnnpnglediqktriftflsfvsdelrkenmftemyvtelemy
    ksklfiamrdesvplpyinyehlrtrcetfkrnqaeceakvadvasrlkiklehleenkl
    rpleipkekeapythkflmkdawffakphdseraqpqqilydffeaanmgfmttspkpif
    gkqglmyhslwgqtkraikdkrnelepseqrdflcgigraskkiqedkwqesreeefkqe
    etkgaakrgfptwfneewlwamrdskigdwipmaemppcknemedyakkmceeleskiqg
    tncaremsklihtigslhtecrnfpgkvkivpiycrgtlrgestdclfgiaikgkshlnk
    ddgmytvvtfefsteepnpskhekytvfeagtvpveakekklflycrttgmsklkndwfs
    kcrrcliptmetveqivlkecalkeenrvsemlenkrawiahengenltrlvstklkdlc
    rmlivtqfyyciyndnqlegfcneqkkflmflqadkdsksaftfnqkglyekieecivsn
    plcifladrlnklflvaksngakyfe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ju3B (B:)
    meinpyllmlnnditsmisltypytgappmshgtstkysmetvsrtysysrtkkevpsgi
    fpierrkfcntiedkenlekpngnvdinfmlslaemleekmgkgffkfcaneaeaeilkm
    hfskltegrqtydwtsernmpaatalqltvdaiqetqgtfkgttmveycnkilemmdwpe
    vkfkkvrmivqrhwdpktkkeikmksptlmitkigreefikrictintmakdgergkykr
    raiatpgmgirpfskivetlaqkicerlaesglpvggnekkaklkttvsstnsklqegqf
    mvnitgdnskwnecqqpeaylamlayitkdssnlmkdlcsvaptlfcnkyvkmgqgfrak
    nkrktkeivipakkmkerkelmnaewrdlfetiepymdgeccflgggmlmgmfnmlstvf
    gvmtlnyreealarrncywtglqssddfvlfcisrtwpememtilkfiavcklmginmsl
    eksygclpelfeftsmffsgdfvsnialelpafttagmnegtdftaamsvirtnminngl
    spgtalmalriclqefratyrvhpydsgvknhrmkiirkfietienkdgllisdggklmn
    nisslhipeeilkedlmdpsyrnrvfnprnpftqfektvdifkasgpirveeneavvsth
    sfrtrsnrtllntdmramaleekryqvvcnmyrsvfesadvntpigsmsmgeaieakild
    rartqfengiiggeeyseikrliedakrqrlsv
    

    Sequence, based on observed residues (ATOM records):
    >6ju3B (B:)
    meinpyllmlnnditsmisltypytgappmshgtstkysmetvsrtysysrtkkevpsgi
    fpierrkfcntiedkenlekpngnvdinfmlslaemleekmgkgffkfcaneaeaeilkm
    hfskltegrqtydwtsernmpaatalqltvdaiqetqgtfkgttmveycnkilemmdwpe
    vkfkkvtlmitkigreefikrictintmakdgergkykrraiatpgmgirpfskivetla
    qkicerlaesglpekkaklkttvsstnsklqegqfmvnitgdnskwnecqqpeaylamla
    yitkdssnlmkdlcsvaptlfcnkyvkmgqgfraknkrktkeivipakkmkerkelmnae
    wrdlfetiepymdgeccflgggmlmgmfnmlstvfgvmtlnyreerncywtglqssddfv
    lfcisrtwpememtilkfiavcklmginmsleksygclpelfeftsmffsgdfvsniale
    lpafttagmnegtdftaamsvirtnminnglspgtalmalriclqefratyrvhpydsgv
    knhrmkiirkfietienkdgllisdggklmnnisslhipeeilkedlmdpsyrnrvfnpr
    npfavvsthsfrtrsnrtllntdmramaleekryqvvcnmyrsvfesadvntpigsmsmg
    eaieakildrartqfengiiggeeyseikrliedakrqrlsv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ju3C (C:)
    msllltlakeyanltkdkksckllsqgtvssyttfkkwttsrkeknpslrmrwamgskfp
    imanreileeagipeqwegidlwskkddvsklgmvlaspaaitywnfcgpgvdnssvikd
    vykakfmkkerwretlwgpmnfelvgkqrrvvetqpveiklnqkeikeltmwvlfedean
    laskfiqenfslvlslrelykgkavnkdvaafmiahqfspekrflptfgpirpermellh
    clggdfwkieavtagslneeqkkrdvravarkiclrasvdlftpaekirdyiasvtmrfg
    tvertfedvirnsddisaevtlckaalgcelgksmsfgnlnlrkvsgeaetmektvywgl
    kpikykcwrgeetfycelrkvtcmfrrsegldwanigpgspeerrellamvmifcrdgrf
    fesapvnidesffrtrlnkeipyqyvllkwvrqsrdnldallstrglipahigqfgkgmg
    idgsssssmvykgvmlsktpidiveskekhrlflndnieavtergamvasimdlsednre
    tfndvtfnhvdlavlkdektaiikiyrslverintdddglpalimgkrylelyqldevkd
    avglipkrmlgaysyqarqliqsqikndsyslpeiikllpfcysppkkmlfdgtfhfknq
    myvrpgintnlfsfsktdkskiyvngsavkiklvlgddemdtslafvegfqvceydprap
    liprrdlrligfgkkvrvfvgqgqektlvrtsskraashdvsknirrmrlev
    

    Sequence, based on observed residues (ATOM records):
    >6ju3C (C:)
    sllltlakeyanltkdkksckllsqgtvssyttfkkwttsrkeknpslrmrwamgskfpi
    manreileeagipeqwegidlwskkdlgmvlaspaaitywnfcgpgvdnssvikdvykak
    fmkkerwretlwgpmnfelvgkqrrvvetqpveiklnqkeikeltmwvlfedeanlaskf
    iqenfslvlslrelykgkavnkdvaafmiahqfspekrflptfgpirpermellhclggd
    fwkieavta
    

  • Chain 'R':
    No sequence available.

  • Chain 'V':
    No sequence available.