PDB entry 6jtd

View 6jtd on RCSB PDB site
Description: Crystal structure of TcCGT1 in complex with UDP
Class: transferase
Keywords: C-glycosyltransferase, glycosyltransferase, TRANSFERASE
Deposited on 2019-04-10, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-glycosyltransferase
    Species: Trollius chinensis [TaxId:78479]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JTD
    Domains in SCOPe 2.08: d6jtda_
  • Chain 'B':
    Compound: C-glycosyltransferase
    Species: Trollius chinensis [TaxId:78479]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JTD
    Domains in SCOPe 2.08: d6jtdb_
  • Heterogens: UDP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jtdA (A:)
    meksnpnstskphvfllaspgmghlipflelskrlvtlntlqvtlfivsneatkarshlm
    essnnfhpdlelvdltpanlsellstdatvfkriflitqaaikdlesrissmstppaali
    vdvfsmdafpvadrfgikkyvfvtlnawflalttyvrtldreiegeyvdlpepiaipgck
    plrpedvfdpmlsrssdgyrpylgmserltkadglllntwealepvslkalreneklnqi
    mtpplypvgpvarttvqevvgnecldwlskqptesvlyvalgsggiisykqmtelawgle
    msrqrfiwvvrlptmekdgacrffsdvnvkgpleylpegfldrnkelgmvlpnwgpqdai
    lahpstggflshcgwnsslesivngvpviawplyaeqkmnatllteelgvavrpevlptk
    avvsrdeiekmvrrvieskegkmkrnrarsvqsdalkaiekggssyntlievakefeknh
    kvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jtdA (A:)
    npnstskphvfllaspgmghlipflelskrlvtlntlqvtlfivsneatkarshlmessn
    nfhpdlelvdltpanlsellstdatvfkriflitqaaikdlesrissmstppaalivdvf
    smdafpvadrfgikkyvfvtlnawflalttyvrtldreiegeyvdlpepiaipgckplrp
    edvfdpmlsrssdgyrpylgmserltkadglllntwealepvslkalreneklnqimtpp
    lypvgpvarttvqevvgnecldwlskqptesvlyvalgsggiisykqmtelawglemsrq
    rfiwvvrlptmekdgacrffsdvnvkgpleylpegfldrnkelgmvlpnwgpqdailahp
    stggflshcgwnsslesivngvpviawplyaeqkmnatllteelgvavrpevlptkavvs
    rdeiekmvrrvieskegkmkrnrarsvqsdalkaiekggssyntlievakefeknhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jtdB (B:)
    meksnpnstskphvfllaspgmghlipflelskrlvtlntlqvtlfivsneatkarshlm
    essnnfhpdlelvdltpanlsellstdatvfkriflitqaaikdlesrissmstppaali
    vdvfsmdafpvadrfgikkyvfvtlnawflalttyvrtldreiegeyvdlpepiaipgck
    plrpedvfdpmlsrssdgyrpylgmserltkadglllntwealepvslkalreneklnqi
    mtpplypvgpvarttvqevvgnecldwlskqptesvlyvalgsggiisykqmtelawgle
    msrqrfiwvvrlptmekdgacrffsdvnvkgpleylpegfldrnkelgmvlpnwgpqdai
    lahpstggflshcgwnsslesivngvpviawplyaeqkmnatllteelgvavrpevlptk
    avvsrdeiekmvrrvieskegkmkrnrarsvqsdalkaiekggssyntlievakefeknh
    kvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jtdB (B:)
    skphvfllaspgmghlipflelskrlvtlntlqvtlfivsneatkarshlmessnnfhpd
    lelvdltpanlsellstdatvfkriflitqaaikdlesrissmstppaalivdvfsmdaf
    pvadrfgikkyvfvtlnawflalttyvrtldreiegeyvdlpepiaipgckplrpedvfd
    pmlsrssdgyrpylgmserltkadglllntwealepvslkalreneklnqimtpplypvg
    pvarttvqevvgnecldwlskqptesvlyvalgsggiisykqmtelawglemsrqrfiwv
    vrlptmekdgacrffsdvnvkgpleylpegfldrnkelgmvlpnwgpqdailahpstggf
    lshcgwnsslesivngvpviawplyaeqkmnatllteelgvavrpevlptkavvsrdeie
    kmvrrvieskegkmkrnrarsvqsdalkaiekggssyntlievakefeknh