PDB entry 6jsx

View 6jsx on RCSB PDB site
Description: structure of a flagellin protein, hpflag
Deposited on 2019-04-08, released 2020-04-08
The last revision was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar biosynthesis protein FlaG
    Species: Helicobacter pylori [TaxId:210]
    Gene: BB430_02730, HPY1198_01455
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Flagellar biosynthesis protein FlaG
    Species: Helicobacter pylori [TaxId:210]
    Gene: BB430_02730, HPY1198_01455
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jsxA (A:)
dqykpklellserlneemkrigtdinfsyndtikglvvsvkdangdkvireipskeavel
mqrmrdvigiifd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6jsxB (B:)
dqykpklellserlneemkrigtdinfsyndtikglvvsvkdangdkvireipskeavel
mqrmrdvigiifd