PDB entry 6jsd

View 6jsd on RCSB PDB site
Description: crystal structure of the domain-swapped dimer h434a variant of the c- terminal domain of htaa from corynebacterium glutamicum
Deposited on 2019-04-08, released 2019-11-20
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical membrane protein
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cgl0388
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NTB9 (1-End)
      • engineered mutation (71)
  • Chain 'B':
    Compound: hypothetical membrane protein
    Species: Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) [TaxId:196627]
    Gene: Cgl0388
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NTB9 (1-End)
      • engineered mutation (71)
  • Heterogens: IPA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jsdA (A:)
    mslgvtqasaqwgvkasfqnyirgsiangswtlngvgfdnqqfqfsgnsgavdaenktgs
    infpgsihftgaggildmqianieisfngnsgeliadvvssdmdgnstnygrtvvgtlnf
    salnvsateasgsasvslsqsgsqafadfytpgtqldpisfsatlgglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6jsdA (A:)
    slgvtqasaqwgvkasfqnyirgsiangswtlngvgfdnqqfqfsgnsgavdaenktgsi
    nfpgsihftgaggildmqianieisfngnsgeliadvvssdmdgnstnygrtvvgtlnfs
    alnvsateasgsasvslsqsgsqafadfytpgtqldpisfsatlg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6jsdB (B:)
    mslgvtqasaqwgvkasfqnyirgsiangswtlngvgfdnqqfqfsgnsgavdaenktgs
    infpgsihftgaggildmqianieisfngnsgeliadvvssdmdgnstnygrtvvgtlnf
    salnvsateasgsasvslsqsgsqafadfytpgtqldpisfsatlgglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6jsdB (B:)
    slgvtqasaqwgvkasfqnyirgsiangswtlngvgfdnqqfqfsgnsgavdaenktgsi
    nfpgsihftgaggildmqianieisfngnsgeliadvvssdmdgnstnygrtvvgtlnfs
    alnvsateasgsasvslssqafadfytpgtqldpisfsatlg